PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 234aa    MW: 27174 Da    PI: 9.8451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00328.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-162873148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W  eEd +lv++++ +G g+W+++ar++   R++k+c++rw++yl
       KHN00328.1 28 KGPWAVEEDTILVNYIATHGEGHWNSVARCLR--RSGKSCRLRWLNYL 73
                     79*****************************8..************97 PP

2Myb_DNA-binding47.73.7e-1579122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+ l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
       KHN00328.1  79 RGNITLQEQILILDLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 122
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6032373IPR017930Myb domain
SuperFamilySSF466893.11E-2824120IPR009057Homeodomain-like
SMARTSM007173.1E-142775IPR001005SANT/Myb domain
PfamPF002492.0E-142873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-202980IPR009057Homeodomain-like
CDDcd001672.04E-103073No hitNo description
PROSITE profilePS5129422.39374128IPR017930Myb domain
SMARTSM007178.4E-1378126IPR001005SANT/Myb domain
PfamPF002491.7E-1379122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2181126IPR009057Homeodomain-like
CDDcd001674.37E-983122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MDVKKGGSVV QAQVKLQKHN EKEMGMRKGP WAVEEDTILV NYIATHGEGH WNSVARCLRR  60
SGKSCRLRWL NYLRPDVRRG NITLQEQILI LDLHSRWGNR WSKIAQQLPG RTDNEIKNYW  120
RTRVIKQAKQ LKCDVNSKQF RDTLRYVWMP RLLERLQPTS QALEPNQSGL VLHASSSLLP  180
SNSDRSIERG SDLWPGFNNQ MLLEQGSGGD LLESLWDDDN MCFLQQLSYD LQMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-2531204120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150416e-53AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536859.11e-171PREDICTED: transcription factor MYB108
SwissprotQ9LDE11e-71MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0B2NYN71e-173A0A0B2NYN7_GLYSO; Myb-related protein 305
STRINGGLYMA10G01330.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.14e-75myb domain protein 78
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]